PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 273aa    MW: 30898.8 Da    PI: 8.2215
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0156genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-164186148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T  E++l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_A09G0156 41 RGNFTDHEEKLIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 86
                     89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.2281635IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-102146IPR009057Homeodomain-like
SuperFamilySSF466897.56E-222197IPR009057Homeodomain-like
PROSITE profilePS5129424.0493690IPR017930Myb domain
SMARTSM007171.9E-154088IPR001005SANT/Myb domain
PfamPF002491.7E-144186IPR001005SANT/Myb domain
CDDcd001671.41E-104386No hitNo description
Gene3DG3DSA:1.10.10.601.1E-204791IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEVIGTFMFL KATLLHLSGL HRCSKSCRLR WTNYLRPGIK RGNFTDHEEK LIIHLQALLG  60
NRWAAIASYL PQRTDNDIKN YWNTHLKKKL KTINGSESYS REGFSSEKHQ ISRGQWERKL  120
QTDIQMAKQA LSDALSPEKS SGLASKPRGY ASSTENIAKL LKKWMRNPPK PVSSDNMGGI  180
GTPWKENKSS NSIEMSEVFE SLEVFESFDS SNSDFSQSLS PDQASLFQDE SKPDVNELGQ  240
LTLLEKWLFD DGASQGKDDQ LSDIKLDGNA IFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2019219110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18591LKKKLKT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.228592e-53boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483622.11e-174PREDICTED: myb-related protein 306-like
SwissprotP813921e-75MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2SQT61e-174A0A0D2SQT6_G
STRINGVIT_14s0108g00830.t012e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.12e-69myb domain protein 30